REI Gene Information


Name : unnamed
Accession : BAA82239.2
REI name : Type-II SCCmec
REI accession : D86934
Strain : Staphylococcus aureus 04-02981
Resistance or Virulence: Not determined
Product : -
Function : -
Note : unnamed protein product; ORF CN049
Homologs in the searched genomes :   19 hits    ( 19 protein-level )  
Publication :
    -Hiramatsu,K., Asada,K., Suzuki,E., Okonogi,K. and Yokota,T., "Molecular cloning and nucleotide sequence determination of the regulator region of mecA gene in methicillin-resistant Staphylococcus aureus (MRSA)", FEBS Lett. 298 (2-3), 133-136 (1992) PUBMED 1544435.

    -Ito,T., Asada,K., Katayama,Y. and Hiramatsu,K., "Direct Submission", Submitted (07-AUG-1996) Contact:Teruyo Ito Juntendo University, Faculty of Medicine, Department of Bacteriology; 2-1-1 Hongo, Bunkyo-ku, Tokyo 113-8421, Japan.

    -Ito,T., Katayama,Y. and Hiramatsu,K., "Cloning and nucleotide sequence determination of the entire mec DNA of pre-methicillin-resistant Staphylococcus aureus N315", Antimicrob. Agents Chemother. 43 (6), 1449-1458 (1999) PUBMED 10348769.

    -Ito,T., Katayama,Y., Asada,K., Mori,N., Tsutsumimoto,K., Tiensasitorn,C. and Hiramatsu,K., "Structural comparison of three types of staphylococcal cassette chromosome mec integrated in the chromosome in methicillin-resistant Staphylococcus aureus", Antimicrob. Agents Chemother. 45 (5), 1323-1336 (2001) PUBMED 11302791 REMARK Erratum:[Antimicrob Agents Chemother 2001 Dec;45(12):3677].

    -Ito,T., Okuma,K., Ma,X.X., Yuzawa,H. and Hiramatsu,K., "Insights on antibiotic resistance of Staphylococcus aureus from its whole genome: genomic island SCC", Drug Resist. Updat. 6 (1), 41-52 (2003) PUBMED 12654286.


DNA sequence :
ATGAGTGATAATTTGTCATTATTCATTGACTATATCAATGATAATATAATCTATGGTAGTGAAATCAAACGGGAGAAATT
AGAGAATTTATTTAATCAATTTGCTATAAAAAATGTTGAAAAGAACATTGTCTATGATGAACTGAAATCTTTAGATATTA
CAATCATTGAGTCACAGGATTCATATAAAAATAAATTGAAGAGATTATTTTCGGTTCTGTTGCAAAGTAAAAAAATATAG

Protein sequence :
MSDNLSLFIDYINDNIIYGSEIKREKLENLFNQFAIKNVEKNIVYDELKSLDITIIESQDSYKNKLKRLFSVLLQSKKI