Name : unnamed Accession : BAA94327.1 REI name : Type-I SCCmec REI accession : AB033763 Strain : Staphylococcus aureus 04-02981 Resistance or Virulence: Not determined Product : hypothetical protein Function : - Note : ORF No. CE020 Homologs in the searched genomes : No hits Publication :
-Ito,T., Katayama,Y., Asada,K., Mori,N., Tsutsumimoto,K., Tiensasitorn,C. and Hiramatsu,K., "Structural comparison of three types of staphylococcal cassette chromosome mec integrated in the chromosome in methicillin-resistant Staphylococcus aureus", Antimicrob. Agents Chemother. 45 (5), 1323-1336 (2001) PUBMED 11302791 REMARK Erratum:[Antimicrob Agents Chemother 2001 Dec;45(12):3677]. -Ito,T., Okuma,K., Ma,X.X., Yuzawa,H. and Hiramatsu,K., "Insights on antibiotic resistance of Staphylococcus aureus from its whole genome: genomic island SCC", Drug Resist. Updat. 6 (1), 41-52 (2003) PUBMED 12654286. DNA sequence : TTGCGCAATTTTTTTATAACCATAACCTTGAAGGTAATAATTGAACACAGCTTTTACTGTTGGTGCTTTTACTGTGTCTA TCGTGAAAGTACCATTATGATAGTGATACCCAAAGGGTGCATGTGTTGTAATCATTTTACCTTGTTTCGCTTTTTCTTTG ATTCCATTTTTGACTTGTTCGCCTATATTATCAGATTCTAG Protein sequence : MRNFFITITLKVIIEHSFYCWCFYCVYRESTIMIVIPKGCMCCNHFTLFRFFFDSIFDLFAYIIRF |