Name : kdpC (SA0071) Accession : NP_373311.1 REI name : Type-II SCCmec REI accession : NC_002745_R1 Strain : Staphylococcus aureus 04-02981 Resistance or Virulence: Not determined Product : hypothetical protein Function : - Note : potassium-transporting ATPase C chain homologue Homologs in the searched genomes : 46 hits ( 46 protein-level ) Publication :
-Beenken,K.E., Dunman,P.M., McAleese,F., Macapagal,D., Murphy,E., Projan,S.J., Blevins,J.S. and Smeltzer,M.S., "Global gene expression in Staphylococcus aureus biofilms", J. Bacteriol. 186 (14), 4665-4684 (2004) PUBMED 15231800. -Bischoff,M., Dunman,P., Kormanec,J., Macapagal,D., Murphy,E., Mounts,W., Berger-Bachi,B. and Projan,S., "Microarray-based analysis of the Staphylococcus aureus sigmaB regulon", J. Bacteriol. 186 (13), 4085-4099 (2004) PUBMED 15205410. -Director-General, Biotechnology Center, Aoki,K., Oguchi,A., Hosoyama,A., Nagai,Y., Kuroda,M., Hiramatsu,K. and Kikuchi,H., "Direct Submission", Submitted (30-JAN-2001) Director-General, Biotechnology Center, National Institute of Technology and Evaluation, Biotechnology Center; 2Chome 49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan (E-mail:bio@nite.go.jp, URL:http://www.bio.nite.go.jp/, Tel:81. -Dunman,P.M., Murphy,E., Haney,S., Palacios,D., Tucker-Kellogg,G., Wu,S., Brown,E.L., Zagursky,R.J., Shlaes,D. and Projan,S.J., "Transcription profiling-based identification of Staphylococcus aureus genes regulated by the agr and/or sarA loci", J. Bacteriol. 183 (24), 7341-7353 (2001) PUBMED 11717293. -Jang,H.J., Nde,C., Toghrol,F. and Bentley,W.E., "Microarray analysis of toxicogenomic effects of ortho-phenylphenol in Staphylococcus aureus", BMC Genomics 9, 411 (2008) PUBMED 18793396 REMARK Publication Status: Online-Only. -Kuroda,M., Ohta,T., Uchiyama,I., Baba,T., Yuzawa,H., Kobayashi,I., Cui,L., Oguchi,A., Aoki,K., Nagai,Y., Lian,J., Ito,T., Kanamori,M., Matsumaru,H., Maruyama,A., Murakami,H., Hosoyama,A., Mizutani-Ui,Y., Takahashi,N.K., Sawano,T., Inoue,R., Kaito,C., Seki, "Whole genome sequencing of meticillin-resistant Staphylococcus aureus", Lancet 357 (9264), 1225-1240 (2001) PUBMED 11418146. -Kuroda,M., Ohta,T., Uchiyama,I., Baba,T., Yuzawa,H., Kobayashi,I., Cui,L., Oguchi,A., Aoki,K., Nagai,Y., Lian,J., Ito,T., Kanamori,M., Matsumaru,H., Maruyama,A., Murakami,H., Hosoyama,A., Mizutani-Ui,Y., Takahashi,N.K., Sawano,T., Inoue,R., Kaito,C., Seki, "Direct Submission", Submitted (10-SEP-2004) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA. -Luong,T.T., Dunman,P.M., Murphy,E., Projan,S.J. and Lee,C.Y., "Transcription Profiling of the mgrA Regulon in Staphylococcus aureus", J. Bacteriol. 188 (5), 1899-1910 (2006) PUBMED 16484201. -McAleese,F., Wu,S.W., Sieradzki,K., Dunman,P., Murphy,E., Projan,S. and Tomasz,A., "Overexpression of genes of the cell wall stimulon in clinical isolates of Staphylococcus aureus exhibiting vancomycin-intermediate- S. aureus-type resistance to vancomycin", J. Bacteriol. 188 (3), 1120-1133 (2006) PUBMED 16428416. -Michel,A., Agerer,F., Hauck,C.R., Herrmann,M., Ullrich,J., Hacker,J. and Ohlsen,K., "Global regulatory impact of ClpP protease of Staphylococcus aureus on regulons involved in virulence, oxidative stress response, autolysis, and DNA repair", J. Bacteriol. 188 (16), 5783-5796 (2006) PUBMED 16885446. -Resch,A., Rosenstein,R., Nerz,C. and Gotz,F., "Differential gene expression profiling of Staphylococcus aureus cultivated under biofilm and planktonic conditions", Appl. Environ. Microbiol. 71 (5), 2663-2676 (2005) PUBMED 15870358. -Seggewiss,J., Becker,K., Kotte,O., Eisenacher,M., Yazdi,M.R., Fischer,A., McNamara,P., Al Laham,N., Proctor,R., Peters,G., Heinemann,M. and von Eiff,C., "Reporter metabolite analysis of transcriptional profiles of a Staphylococcus aureus strain with normal phenotype and its isogenic hemB mutant displaying the small-colony-variant phenotype", J. Bacteriol. 188 (22), 7765-7777 (2006) PUBMED 16980462. -Weinrick,B., Dunman,P.M., McAleese,F., Murphy,E., Projan,S.J., Fang,Y. and Novick,R.P., "Effect of mild acid on gene expression in Staphylococcus aureus", J. Bacteriol. 186 (24), 8407-8423 (2004) PUBMED 15576791. DNA sequence : CTGATTATGTTTGTTTTATGCGGATTTATCTTCCCGCTGACTGTCACAGCGCTTGGACAAGTATTATTTCCAGAACAAGC AAACGGCAGTTTAGTGAAACAAGATGGCAAAGTAATTGGTTCAAAGCTCATTGGACAACAATGGACAGAACCTAAATATT TCCATGGACGTATCAGTGCAGTCAATTACAATATGAATGCGAATGAAGTGAAAGAAAGTGGCGGACCTGCTTCAGGCGGC TCAAACTACGGCAATTCAAATCCTGAATTGAAAAAAAGAGTTCAAGAGACTATTAAACAAGAAGGAAAAAAAATTTCAAG TGATGCGGTGACCGCTTCTGGCTCTGGTTTAGACCCAGATATTACGGTTTGA Protein sequence : MIMFVLCGFIFPLTVTALGQVLFPEQANGSLVKQDGKVIGSKLIGQQWTEPKYFHGRISAVNYNMNANEVKESGGPASGG SNYGNSNPELKKRVQETIKQEGKKISSDAVTASGSGLDPDITV |