Name : rpmJ (cur_1485) Accession : YP_001800879.1 REI name : Not named REI accession : NC_010545_R1 Strain : Corynebacterium urealyticum DSM 7109 Resistance or Virulence: Not determined Product : 50S ribosomal protein L36 Function : - Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io Homologs in the searched genomes : 850 hits ( 850 protein-level ) Publication :
-Tauch,A., Trost,E., Tilker,A., Ludewig,U., Schneiker,S., Goesmann,A., Arnold,W., Bekel,T., Brinkrolf,K., Brune,I., Gotker,S., Kalinowski,J., Kamp,P.B., Lobo,F.P., Viehoever,P., Weisshaar,B., Soriano,F., Droge,M. and Puhler,A., "The lifestyle of Corynebacterium urealyticum derived from its complete genome sequence established by pyrosequencing", J. Biotechnol. 136 (1-2), 11-21 (2008) PUBMED 18367281. -Tauch,A., Trost,E., Tilker,A., Ludewig,U., Schneiker,S., Goesmann,A., Arnold,W., Bekel,T., Brinkrolf,K., Brune,I., Gotker,S., Kalinowski,J., Kamp,P.B., Lobo,F.P., Viehoever,P., Weisshaar,B., Soriano,F., Droge,M. and Puhler,A., "Direct Submission", Submitted (03-APR-2008) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA. DNA sequence : ATGAAGGTCCGTAAGTCCCTTCGGTCGCTGAAGAACAAGCCGGGCGCTCAGGTTGTGCGTCGCCACGGTAAGGTCTACGT CATCAACAAGAAGGATCCGCGTTTCAAGGCTCGCCAGGGCTAA Protein sequence : MKVRKSLRSLKNKPGAQVVRRHGKVYVINKKDPRFKARQG |