REI Gene Information


Name : CDBH8_0903 (CDBH8_0903)
Accession : YP_005159995.1
REI name : Not named
REI accession : NC_016800_R1
Strain : Corynebacterium diphtheriae 241
Resistance or Virulence: Not determined
Product : cobalt/nickel transport system ATP-binding protein
Function : -
Note : -
Homologs in the searched genomes :   1 hits    ( 1 protein-level )  
Publication :
    -Trost,E., Blom,J., Al-Dilaimi,A., Schroeder,J., Soares,S.C., Dorella,F.A., Rocha,F.S., Miyoshi,A., Azevedo,V., Schneider,M.P., Silva,A., Camello,T.C., Sabbadini,P.S., Santos,C.S., Santos,L.S. Jr., Hirata,R., Mattos-Guaraldi,A.L., Efstratiou,A., Schmitt,M., "Direct Submission", Submitted (23-DEC-2011) CeBiTec, Bielefeld University, Universitaetsstr. 27, Bielefeld 33615, Germany.

    -Trost,E., Blom,J., de Castro Soares,S., Huang,I.H., Al-Dilaimi,A., Schroder,J., Jaenicke,S., Dorella,F.A., Rocha,F.S., Miyoshi,A., Azevedo,V., Schneider,M.P., Silva,A., Camello,T.C., Sabbadini,P.S., Santos,C.S., Santos,L.S., Hirata,R. Jr., Mattos-Guaraldi, "Pangenomic Study of Corynebacterium diphtheriae That Provides Insights into the Genomic Diversity of Pathogenic Isolates from Cases of Classical Diphtheria, Endocarditis, and Pneumonia", J. Bacteriol. 194 (12), 3199-3215 (2012) PUBMED 22505676.

    -Trost,E., Blom,J., de Castro Soares,S., Huang,I.H., Al-Dilaimi,A., Schroder,J., Jaenicke,S., Dorella,F.A., Rocha,F.S., Miyoshi,A., Azevedo,V., Schneider,M.P., Silva,A., Camello,T.C., Sabbadini,P.S., Santos,C.S., Santos,L.S., Hirata,R. Jr., Mattos-Guaraldi, "Direct Submission", Submitted (06-FEB-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA.


DNA sequence :
GTGACTGATCATGTCATCGCCCATGCGTTTAGTTATCGGCATGCGAGTCGGCGAAAGCCTGCTCTTGTCGATCTCACATT
GAAAATCTCCCGTGGGGAATGA

Protein sequence :
MTDHVIAHAFSYRHASRRKPALVDLTLKISRGE