Name : CDBH8_0903 (CDBH8_0903) Accession : YP_005159995.1 REI name : Not named REI accession : NC_016800_R1 Strain : Corynebacterium diphtheriae 241 Resistance or Virulence: Not determined Product : cobalt/nickel transport system ATP-binding protein Function : - Note : - Homologs in the searched genomes : 1 hits ( 1 protein-level ) Publication :
-Trost,E., Blom,J., de Castro Soares,S., Huang,I.H., Al-Dilaimi,A., Schroder,J., Jaenicke,S., Dorella,F.A., Rocha,F.S., Miyoshi,A., Azevedo,V., Schneider,M.P., Silva,A., Camello,T.C., Sabbadini,P.S., Santos,C.S., Santos,L.S., Hirata,R. Jr., Mattos-Guaraldi, "Pangenomic Study of Corynebacterium diphtheriae That Provides Insights into the Genomic Diversity of Pathogenic Isolates from Cases of Classical Diphtheria, Endocarditis, and Pneumonia", J. Bacteriol. 194 (12), 3199-3215 (2012) PUBMED 22505676. -Trost,E., Blom,J., de Castro Soares,S., Huang,I.H., Al-Dilaimi,A., Schroder,J., Jaenicke,S., Dorella,F.A., Rocha,F.S., Miyoshi,A., Azevedo,V., Schneider,M.P., Silva,A., Camello,T.C., Sabbadini,P.S., Santos,C.S., Santos,L.S., Hirata,R. Jr., Mattos-Guaraldi, "Direct Submission", Submitted (06-FEB-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA. DNA sequence : GTGACTGATCATGTCATCGCCCATGCGTTTAGTTATCGGCATGCGAGTCGGCGAAAGCCTGCTCTTGTCGATCTCACATT GAAAATCTCCCGTGGGGAATGA Protein sequence : MTDHVIAHAFSYRHASRRKPALVDLTLKISRGE |