Name : Pmu_03530 (Pmu_03530) Accession : YP_005176251.1 REI name : ICEPmu1 REI accession : NC_016808_R1 Strain : Pasteurella multocida 36950 Resistance or Virulence: Not determined Product : hypothetical protein Function : - Note : - Homologs in the searched genomes : 4 hits ( 4 protein-level ) Publication :
-Michael,G.B., Kadlec,K., Sweeney,M.T., Brzuszkiewicz,E., Liesegang,H., Daniel,R., Murray,R.W., Watts,J.L. and Schwarz,S., "ICEPmu1, an integrative conjugative element (ICE) of Pasteurella multocida: structure and transfer", J. Antimicrob. Chemother. (2011) In press PUBMED 22001176 REMARK Publication Status: Available-Online prior to print. -Michael,G.B., Kadlec,K., Sweeney,M.T., Brzuszkiewicz,E., Liesegang,H., Daniel,R., Murray,R.W., Watts,J.L. and Schwarz,S., "Direct Submission", Submitted (06-FEB-2012) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA. DNA sequence : ATGTCATACGATGCAAATGATGCGCTGAATGAAATCGAAGAGGCGCTTAGCGAGCTTGAAAGGGTTGCTGAAGACCTAAT CAACAACAACCCGAATAAAGAATCAGAATTACGCGGCCAAGGGGTTCACCAAGCGACAAAGCACCTCCGTTTTCGTATTC GCAACATCCGCCGCGGCGAAGCAATTTGA Protein sequence : MSYDANDALNEIEEALSELERVAEDLINNNPNKESELRGQGVHQATKHLRFRIRNIRRGEAI |